DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG43742

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:234 Identity:54/234 - (23%)
Similarity:97/234 - (41%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLS----Q 89
            :.||..|...|   .:...:..|..:|.|::|...::||:|.|:.....||::.|....|    .
  Fly    35 VANGHTAITSQ---FMAALYNNSEFFCGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPV 96

  Fly    90 AQFTVTVGTSEYVTGNQH-------LALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCG 146
            .:..:.:.....:..|.|       :||:|:.| |.|...:..:.:....:.:...:|.: ...|
  Fly    97 CKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNF-TAYG 160

  Fly   147 WGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLI---- 207
            ||.|...| ::|.|..:||..:..:.|  :....|:     |..:.|| .||..|:|.|||    
  Fly   161 WGKTEHGN-ISDVLSFIDLVRLPKSMC--YQNINTI-----CAGSTSG-DTCESDSGGPLIGNFV 216

  Fly   208 --TKQDSTVVGISAFVASNGCTLGLPAGFARITSALDWI 244
              .|....:.||::: ....|: ||...:..:.:...||
  Fly   217 HRGKSRDILFGITSY-GDAECS-GLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 54/234 (23%)
Tryp_SPc 29..244 CDD:214473 52/232 (22%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 52/232 (22%)
Tryp_SPc 35..256 CDD:238113 54/234 (23%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.