DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG43336

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:291 Identity:63/291 - (21%)
Similarity:103/291 - (35%) Gaps:73/291 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVFLGLTL-------------VAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIWCS 56
            ||.:|||.             :|.|........|.  :.||:.|....:|::..:........|.
  Fly     3 VVVVGLTFFLLPLLGSTQFLDMACGIRAHSPSVPR--VKNGTVASLTSSPWMAFLHSTDGRFICG 65

  Fly    57 GTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVG---TSEYVTGNQHLALVRVPRV-- 116
            |::|.:..:||:|.|.              |.:.:....:|   ..||...:......|:..:  
  Fly    66 GSLITNRLVLTAAHCF--------------LDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVE 116

  Fly   117 -GFSNR-------VNRVALPSLRNRSQRYEN-----------WWANV--------CGWGVTTFSN 154
             ||.:|       ...:|:..|..:.|..:|           |...:        .|||.|. |.
  Fly   117 RGFRHRHYNPMTMAYDIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTE-SE 180

  Fly   155 GLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSP---LITKQDS---T 213
            |.:..|:.|||.......|..:...:..::|.......|  :.|.||:|.|   ||....|   .
  Fly   181 GDSAKLRTVDLARKHPEVCRRYATLSLTANQFCAGNERS--NLCNGDSGGPVGALIPYGKSKRFV 243

  Fly   214 VVGISAFVASNGCTLGLPAGFARITSALDWI 244
            .|||::| .:..|.  :.:.|..:.|.:|||
  Fly   244 QVGIASF-TNTQCV--MVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 55/254 (22%)
Tryp_SPc 29..244 CDD:214473 53/252 (21%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 53/255 (21%)
Tryp_SPc 40..271 CDD:238113 53/250 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.