DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG43335

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:202 Identity:49/202 - (24%)
Similarity:90/202 - (44%) Gaps:36/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQAQFT 93
            |..||.|.....|::..: :.:.:.:|:||:|.:.::||:|.|:..|..:|:..|.:.|:::..:
  Fly    42 IIGGSDAEITSHPWMAYL-YNEFHYFCAGTLITNQFVLTAAHCIEASKNLTVRLGGSGLTRSDGS 105

  Fly    94 VTVGTSE-----------YVTGN---QHLALVRVPR-VGFSNRVNRVAL---PSLRNRSQRYENW 140
            :...|:|           |.|.:   ..:|::|:.| |.|.:.:..:.:   |::|...:  :..
  Fly   106 MCQITAEDYSVSMAIKHKYFTPSIMLNDIAMIRLARTVKFYDHIRPICIILDPAVRLLLE--DGM 168

  Fly   141 WANVCGWGVTTFSNGLTD------ALQCVDLQIMSNNECIAFYGSTTVSDQILCTRTPSGRSTCF 199
            .....||       ||.|      .||...:.:|:.|.|...|.......|| |..... .:||.
  Fly   169 TLMATGW-------GLADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQI-CAGDKE-TNTCL 224

  Fly   200 GDAGSPL 206
            ||:|.||
  Fly   225 GDSGGPL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 49/202 (24%)
Tryp_SPc 29..244 CDD:214473 49/202 (24%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 49/202 (24%)
Tryp_SPc 42..275 CDD:238113 49/202 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436096
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.