DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and CG43110

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:265 Identity:70/265 - (26%)
Similarity:117/265 - (44%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFLGLTLVAAGSA---------KKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTIIG 61
            :|:.:.|.:.||.         :...:.|...|.:||.|.:..|.|:.|: |..:::.|.||||.
  Fly     4 LFVWIFLCSLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYMAGI-FNTTHLLCGGTIIH 67

  Fly    62 DTWILTSAQCLTGSSGVTIY--FGATRLS----QAQFTVTVGTSEY--VTGNQHLALVRVPR-VG 117
            :.::||.|.|   .|..|::  .||..::    |.:...|:...:|  .|....:|||::.| |.
  Fly    68 EDFVLTVAHC---KSTQTLFVRLGAYNINHPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVI 129

  Fly   118 FSNRVNRVA--LPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGST 180
            |:..:..:.  |.:...:..||    .|..|||.|..:. .:|.||.:.:...:...|..:.|.:
  Fly   130 FNLNIQPICIHLDATLGKQIRY----YNAFGWGRTRNAE-QSDILQRIFVNRTNPMICHLYLGMS 189

  Fly   181 TVSDQILCTRTPSGRSTCFGDAGSPLIT------KQDSTVVGISAFVASNGCTLGLPAGFARITS 239
            ....|| |..|..| .||.||:|.|||:      |...|..||:::.......:||   :..::.
  Fly   190 PDPKQI-CATTDQG-DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGL---YTDVSQ 249

  Fly   240 ALDWI 244
            ...||
  Fly   250 YSGWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 65/233 (28%)
Tryp_SPc 29..244 CDD:214473 63/231 (27%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 63/232 (27%)
Tryp_SPc 36..257 CDD:238113 65/233 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.