DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and LOC1276351

DIOPT Version :10

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_315688.2 Gene:LOC1276351 / 1276351 VectorBaseID:AGAMI1_007702 Length:300 Species:Anopheles gambiae


Alignment Length:110 Identity:24/110 - (21%)
Similarity:40/110 - (36%) Gaps:37/110 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 MIPASDK----------GRFFAFGRVFAGKVSTGMKVRIMGPNYIPGEKKDLYTKSVQRTVI--- 434
            |.|||:.          |.||    :|.|.:.       :.|:......|||.|:.|:...:   
Mosquito     1 MPPASNTIVLKSLSVLLGLFF----IFVGTLK-------LTPHISKDLYKDLRTEYVKYAKVFPL 54

  Fly   435 -----------WMGKRQETVEDVPCGNTVAMVGLDQF-ITKNATL 467
                       |. :|...:.::.||..:|::...:. .|.|.||
Mosquito    55 TALFGVKIPSKWY-RRTVGILEIVCGLAMALIPYHKVKNTANVTL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..244 CDD:214473
LOC1276351XP_315688.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.