DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Cela1

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:274 Identity:73/274 - (26%)
Similarity:119/274 - (43%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIW---CSGTIIGD 62
            |...:||  .:||..|.:.:|..:.|..:..|:.|.....|..:.:.:.....|   |.||:|..
Mouse     1 MLRFLVF--ASLVLCGHSTEDVPETDARVVGGAEARRNSWPSQISLQYQYGGSWHHTCGGTLIRS 63

  Fly    63 TWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEY----------------VTGNQHLALV 111
            .|::|:|.|:.......:..|...|||..     ||.:|                |.....:||:
Mouse    64 NWVMTAAHCVDSPMTYRVVVGEHNLSQND-----GTEQYVNVQKIVSHPYWNKNNVVAGYDIALL 123

  Fly   112 RVPR-VGFSNRVNRVALPS----LRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNN 171
            |:.: |..:|.|....||.    |.|.|..|      :.|||.|..:..|...||...|..:|.:
Mouse   124 RLAKSVTLNNYVQLGVLPREGTILANNSPCY------ITGWGRTRTNGELAQTLQQAYLPSVSYS 182

  Fly   172 EC--IAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPL--ITKQDSTVVGISAFVASNGCTLG-LP 231
            .|  .:::|| :|.:.::|......||.|.||:|.||  :......|.|:::||:|.||.:. .|
Mouse   183 ICSSSSYWGS-SVKNTMVCAGGDGVRSGCQGDSGGPLHCMVNGQYAVHGVTSFVSSMGCNVARKP 246

  Fly   232 AGFARITSALDWIH 245
            ..|.|:::.:.|::
Mouse   247 TVFTRVSAYISWMN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 65/246 (26%)
Tryp_SPc 29..244 CDD:214473 64/243 (26%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 64/243 (26%)
Tryp_SPc 27..262 CDD:238113 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.