DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and Ctrl

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:274 Identity:71/274 - (25%)
Similarity:126/274 - (45%) Gaps:45/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVVFLGLTLVAAGS-------AKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNIWCSGTII 60
            :|::.|.|:||..||       |...:...:..|.||..|..|..|:.|.:.......:|.|::|
Mouse     1 MLLLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLI 65

  Fly    61 GDTWILTSAQC-LTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTG--------NQHLALVRVPR- 115
            ...|::|:|.| :|......:.....|.|.|:....:..:..:|.        |..|.|:::.. 
Mouse    66 SPNWVVTAAHCQVTPGRHFVVLGEYDRSSNAEPVQVLSIARAITHPNWNANTMNNDLTLLKLASP 130

  Fly   116 VGFSNRVNRV-------ALPSLRNRSQRYENWWANVC---GWGVTTFSNGLTDA-LQCVDLQIMS 169
            ..::.:|:.|       ||||            ...|   |||..:....:|.| ||.|.|.:::
Mouse   131 ARYTAQVSPVCLASTNEALPS------------GLTCVTTGWGRISGVGNVTPARLQQVVLPLVT 183

  Fly   170 NNECIAFYGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDST--VVGISAFVASNGCTLGLPA 232
            .|:|..::|: .::|.::|. ..||.|:|.||:|.||:.::.:|  ::||.::...| |.:..||
Mouse   184 VNQCRQYWGA-RITDAMICA-GGSGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKN-CNIQAPA 245

  Fly   233 GFARITSALDWIHQ 246
            .:.|::....||:|
Mouse   246 MYTRVSKFSTWINQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 62/239 (26%)
Tryp_SPc 29..244 CDD:214473 60/237 (25%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 60/238 (25%)
Tryp_SPc 34..260 CDD:238113 63/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.