DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and PRSS21

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:280 Identity:60/280 - (21%)
Similarity:105/280 - (37%) Gaps:42/280 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFLGLTLVAAGSAKKDSEDPDHI------------ITNGSPAYEGQAPYVVGMAFGQSNIWCSGT 58
            :.|.|.|..||..|.:|::...:            |..|..|..|:.|:...:....|:: |..:
Human     7 LLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHV-CGVS 70

  Fly    59 IIGDTWILTSAQC------LTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGNQHL--------- 108
            ::...|.||:|.|      |:..||..:.||......:.:::....:.|...|.:|         
Human    71 LLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSP 135

  Fly   109 ---ALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTD--ALQCVDLQI 167
               |||::.. |.::..:..:.|.:.....:...:.|  |.|||.......|..  .||.|.:.|
Human   136 YDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCW--VTGWGYIKEDEALPSPHTLQEVQVAI 198

  Fly   168 MSNNECIAF-----YGSTTVSDQILCTRTPSGRSTCFGDAGSPLITKQDSTVVGISAFVASNGC- 226
            ::|:.|...     :......|.:.......|:..||||:|.||...::.....|.......|| 
Human   199 INNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCG 263

  Fly   227 TLGLPAGFARITSALDWIHQ 246
            ....|..:..|:...:||.:
Human   264 RPNRPGVYTNISHHFEWIQK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 53/243 (22%)
Tryp_SPc 29..244 CDD:214473 51/241 (21%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 53/243 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.