DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and cela1.2

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:272 Identity:64/272 - (23%)
Similarity:117/272 - (43%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLVVFLGLTLVAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAF---GQSNIWCSGTIIGDTW 64
            ||:..|....:|.....||....:.:: .|..|.....|:.:.:.:   |....:||||:|...|
Zfish     5 LLLSVLATLALAEPRYLKDIAIEERVV-GGEIAKPHSWPWQISLQYSDLGTYYYYCSGTLIRPGW 68

  Fly    65 ILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSEYVTGNQ----------------HLALVRV 113
            ::.:|.|:......|:..|...:...:     |..:|::.::                .:||:|:
Zfish    69 VMVAAHCVEALRKWTVALGDHDIYTHE-----GPEQYISVSEVFIHPNWNPNNVAFGYDIALLRL 128

  Fly   114 P-RVGFSNRVNRVALPSLRNRSQRYENWWANVC---GWGVTTFSNGLTDALQCVDLQIMSNNECI 174
            . ....|:.|....|||......     :.:.|   |||.|.....|:..|:...:.::....|.
Zfish   129 SIDATLSSYVQVATLPSSGEILP-----YGHTCYITGWGYTETGGSLSAQLKQAYMPVVDYETCS 188

  Fly   175 A--FYGSTTVSDQILCTRTPSGRSTCFGDAGSPL--ITKQDSTVVGISAFVASNGC-TLGLPAGF 234
            .  ::|| :|.:.::|....:..|.|.||:||||  :......|.|:::||:..|| |...|.||
Zfish   189 QKDWWGS-SVKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVHGVTSFVSPEGCNTYKKPTGF 252

  Fly   235 ARITSALDWIHQ 246
            .|:::.::||:|
Zfish   253 TRVSAYINWINQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 57/244 (23%)
Tryp_SPc 29..244 CDD:214473 55/242 (23%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 55/244 (23%)
Tryp_SPc 30..265 CDD:238113 58/247 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.