DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3088 and zgc:163079

DIOPT Version :9

Sequence 1:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:239 Identity:69/239 - (28%)
Similarity:110/239 - (46%) Gaps:23/239 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ITNGSPAYEGQAPYVVGMAF-GQSNIWCSGTIIGDTWILTSAQ--CLTGSSGVTIYFG-----AT 85
            |..|..|.:|..|:...:.. .....:|.|::|...|:||:|:  .|..:|.:.:|.|     .:
Zfish    36 IIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGRQTQNGS 100

  Fly    86 RLSQAQFTVT--VGTSEYVTGNQHLALVRVPR-VGFSNRVNRVALPSLRNRSQRYENWWANVCGW 147
            ...:...|||  :....|.:.:.:|||:::.. |.||:.:..|.|.:..:........|  |.||
Zfish   101 NPYEISRTVTKIIKHPNYNSLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFVDGTASW--VTGW 163

  Fly   148 G-----VTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQILCT--RTPSGRSTCFGDAGSP 205
            |     .|.....|.|.||.|:..|::|.||.|.||. .:::::||.  ....|::.|.||.|.|
Zfish   164 GYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGG-IITNKLLCAGYLNEDGKAPCAGDVGGP 227

  Fly   206 LITKQDSTVVGISAFVASNGCTL-GLPAGFARITSALDWIHQRT 248
            |:.||.:..:. |..|.|..|.| |.|..:.|::...|||...|
Zfish   228 LVIKQGAIWIQ-SGVVVSGYCGLPGYPTIYVRVSEYEDWISYYT 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 68/235 (29%)
Tryp_SPc 29..244 CDD:214473 66/233 (28%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 66/233 (28%)
Tryp_SPc 36..267 CDD:238113 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.