DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3222 and CG14490

DIOPT Version :9

Sequence 1:NP_648333.1 Gene:CG3222 / 39114 FlyBaseID:FBgn0036014 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_611274.1 Gene:CG14490 / 37041 FlyBaseID:FBgn0034281 Length:197 Species:Drosophila melanogaster


Alignment Length:188 Identity:47/188 - (25%)
Similarity:69/188 - (36%) Gaps:46/188 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEGAWDRLVNVMDGFGSYRYPDGSEYRGRFHQGQFHGYGHLRL----AQPYRFTVKGEFEHGRLV 79
            |:|.|  |.....|||..:...|..|.|.:.:||.||.|.||.    .:..|..| |::...:..
  Fly    22 YQGKW--LGQQPHGFGVKQTSSGLVYEGHWQKGQRHGIGSLRRKELDGRMERIYV-GQWRENKRS 83

  Fly    80 TVEDMWFSDGLHVDGRF-------NGMVLQCD------EW--DYLTPKDRRYHAE-RRY-----G 123
            .....::.||....|::       .|::.|.|      ||  |.:..|...:.|. .||     |
  Fly    84 GEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEG 148

  Fly   124 QQPVGPTAFLTSKMQPRNIPEHCYDVEEGLFNSKTCWLTDRPSPLHQFMYVSCPQDKD 181
            ....|...|..:....|        ::.|.::...|    |.|.|      |.||||:
  Fly   149 GCKSGSGVFYHASNGQR--------IQHGFWSKDIC----RTSLL------SLPQDKN 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3222NP_648333.1 COG4642 <19..103 CDD:226989 24/94 (26%)
CG14490NP_611274.1 COG4642 35..170 CDD:226989 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4642
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.