DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG8 and klg

DIOPT Version :9

Sequence 1:NP_001013683.1 Gene:VSIG8 / 391123 HGNCID:32063 Length:414 Species:Homo sapiens
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:149 Identity:38/149 - (25%)
Similarity:61/149 - (40%) Gaps:38/149 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   110 SINLMNLQVSDTATYEC----RVKKTTMATRKVIVTVQARPAVPMCWTEGHM--TYGNDVVLKCY 168
            ::.:.:|:..|...|.|    ::.:..:.|.:::|....| |:|   |.|.:  ..|..:.|:|.
  Fly   161 NLEISDLEPQDAGDYVCQISDKINRDQVHTVEILV
PPSVR-AIP---TSGQLQARKGGPITLECK 221

Human   169 ASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQESFHSSINQGLNNGD-LVLKDISRA 232
            .||...|..| |.|.||      |...|::                    :.:|. |.|:.:.|.
  Fly   222 GSGNPVPSIY-WTKKSG------ANKSTAR--------------------IGDGPILTLEKLERQ 259

Human   233 DDGLYQCTVANNVGYSVCV 251
            ..|:||||..|.||..|.|
  Fly   260 QAGVYQCTADNGVGDPVTV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG8NP_001013683.1 V-set 35..142 CDD:311561 6/35 (17%)
IG_like 160..256 CDD:214653 27/93 (29%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518
IG_like 109..195 CDD:214653 5/33 (15%)
Ig 118..191 CDD:143165 4/29 (14%)
IG_like 205..274 CDD:214653 25/95 (26%)
IGc2 213..273 CDD:197706 23/86 (27%)
IGc2 301..367 CDD:197706
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.