DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSIG8 and side-V

DIOPT Version :9

Sequence 1:NP_001013683.1 Gene:VSIG8 / 391123 HGNCID:32063 Length:414 Species:Homo sapiens
Sequence 2:NP_611765.2 Gene:side-V / 37679 FlyBaseID:FBgn0085400 Length:1174 Species:Drosophila melanogaster


Alignment Length:313 Identity:74/313 - (23%)
Similarity:114/313 - (36%) Gaps:80/313 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    26 GDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPAHHRE------NVFLSYQDKR 84
            |...|:| .|.|..|.|.|..|..........|.|.:.|.|..|.:..:      |:.:.:.|:.
  Fly    39 GPLSEIL-TAVGSEVALPCDLVPGTGIVDKVQLVIWYRQGNVKPIYTFDARGRPLNLGIPWADES 102

Human    85 INHGSLPHLQQRVRF-AASDPSQYDASINLMNLQVSDTATYECRVKKTTMATR--KVIVTVQARP 146
            :       ..::..| ..:||    .::.:.|:|.||...|:|||......||  ::.|||...|
  Fly   103 V-------FNKKAHFHHDTDP----PALRIKNIQTSDAGLYKCRVDFHKSPTRNWRINVTVLVPP 156

Human   147 ----------AVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSY 201
                      |.....|.|....|:.:.|.|.:|||..|....|.:               :|:.
  Fly   157 TALTILDHHGAEIRDQTAGPYLEGDSIDLTCLSSGGVPPPRVSWWR---------------EHAL 206

Human   202 HSELSYQESFHSSINQGLNNGDLVLKDISRAD-DGLYQCTVANNVGYSVCVVEVKVSDSRRI--- 262
            ..: |:|.....|:...|.     ||:|.|.| ..:|.|..:|  |:.|..:..||.....:   
  Fly   207 IDD-SFQVLPDGSVRNVLR-----LKNIQRKDLLTMYTCQASN--GHVVPALTKKVILDMNLPPL 263

Human   263 -----GVIIGIVLGSLLALGCLAVG-------IWGLVCCCCGGSGAGG-ARGA 302
                 |:...::.|:...:.|.|:|       ||         |.||. .|||
  Fly   264 SLLLQGLNHAVIAGTRSHVTCTAIGARPPPEIIW---------SKAGQIVRGA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSIG8NP_001013683.1 V-set 35..142 CDD:311561 27/115 (23%)
IG_like 160..256 CDD:214653 23/96 (24%)
side-VNP_611765.2 Ig 42..153 CDD:299845 30/122 (25%)
IG_like 42..152 CDD:214653 29/121 (24%)
IGc2 179..245 CDD:197706 21/88 (24%)
IG_like 179..245 CDD:214653 21/88 (24%)
Ig <282..348 CDD:299845 11/35 (31%)
IGc2 400..459 CDD:197706
FN3 719..798 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.