Sequence 1: | NP_001013683.1 | Gene: | VSIG8 / 391123 | HGNCID: | 32063 | Length: | 414 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501339.2 | Gene: | rig-4 / 177597 | WormBaseID: | WBGene00004371 | Length: | 2325 | Species: | Caenorhabditis elegans |
Alignment Length: | 209 | Identity: | 45/209 - (21%) |
---|---|---|---|
Similarity: | 73/209 - (34%) | Gaps: | 64/209 - (30%) |
- Green bases have known domain annotations that are detailed below.
Human 82 DKRINHGSLPHLQ-------------QRVRF-------AASDPSQYDASINLMNLQVSDTATY-- 124
Human 125 -----ECRVKKT---TMATRKVIVTVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWA 181
Human 182 KISGHHYPYRAG-SYTSQHSYHSELSYQESFHSSINQGLNNGDLVLKDISRADDGLYQCTVANNV 245
Human 246 GYSVCVVEVKVSDS 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
VSIG8 | NP_001013683.1 | V-set | 35..142 | CDD:311561 | 15/89 (17%) |
IG_like | 160..256 | CDD:214653 | 24/96 (25%) | ||
rig-4 | NP_501339.2 | IG_like | 330..402 | CDD:214653 | 25/103 (24%) |
IGc2 | 338..393 | CDD:197706 | 21/86 (24%) | ||
I-set | 459..543 | CDD:254352 | |||
IGc2 | 478..534 | CDD:197706 | |||
IG_like | 553..639 | CDD:214653 | |||
Ig | 564..635 | CDD:143165 | |||
FN3 | 643..747 | CDD:238020 | |||
FN3 | 756..850 | CDD:238020 | |||
FN3 | 858..954 | CDD:238020 | |||
FN3 | 959..1042 | CDD:238020 | |||
FN3 | 1057..1151 | CDD:238020 | |||
FN3 | 1156..1251 | CDD:238020 | |||
FN3 | 1258..1356 | CDD:238020 | |||
FN3 | 1361..1453 | CDD:238020 | |||
FN3 | 1464..1560 | CDD:238020 | |||
FN3 | 1572..1664 | CDD:238020 | |||
FN3 | 1679..1764 | CDD:238020 | |||
FN3 | 1774..1858 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |