DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42673 and CG14968

DIOPT Version :10

Sequence 1:NP_729510.1 Gene:CG42673 / 39111 FlyBaseID:FBgn0261555 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_647800.1 Gene:CG14968 / 38406 FlyBaseID:FBgn0035431 Length:199 Species:Drosophila melanogaster


Alignment Length:43 Identity:14/43 - (32%)
Similarity:19/43 - (44%) Gaps:6/43 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   739 GTLTPSPLGTMNRNSFAGSSSLNEDIRLSIEQNLNNLEEQLKA 781
            |..|||...|..|:.||      .|:|...|.....||::.:|
  Fly   163 GEATPSDTITPTRHKFA------IDLRTPEEIQAGELEQETEA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42673NP_729510.1 PH-like <352..386 CDD:473070
CG14968NP_647800.1 PTB_LDLRAP_insect-like 23..147 CDD:269982
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.