DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42673 and Fam43b

DIOPT Version :10

Sequence 1:NP_729510.1 Gene:CG42673 / 39111 FlyBaseID:FBgn0261555 Length:904 Species:Drosophila melanogaster
Sequence 2:NP_001386146.1 Gene:Fam43b / 313650 RGDID:1560959 Length:330 Species:Rattus norvegicus


Alignment Length:148 Identity:34/148 - (22%)
Similarity:59/148 - (39%) Gaps:41/148 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HEKTLAMAAPHK--QRHADS------------SAHVVPRSPITK------AFDFLPWTRSRSKVN 47
            |:..||..:..|  ||.:|:            :|..|||:|:.:      |:...|..|||....
  Rat   194 HQTALAAFSDFKRLQRQSDARHVRQQHLRAGGAAASVPRAPLRRLLNAKCAYRPPPGERSRGAPR 258

  Fly    48 MTKVQSQPAEQQASVSTVTPAEKSSEVHYHKNIFRSGGGLIR---DILVGDKNLQ---LKDKPPQ 106
            ::.:|.:..|:.|.......:|              ||.|.|   ::|...:.|:   |:..|..
  Rat   259 LSSIQEEDEEEDAEEEDAQDSE--------------GGALQRERPEVLSLARELRTCSLRGAPAP 309

  Fly   107 SPVPSHKKKQKHLSRNKS 124
            .| |:..::.|..||.::
  Rat   310 PP-PAQPRRWKAGSRERA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42673NP_729510.1 PH-like <352..386 CDD:473070
Fam43bNP_001386146.1 PH-like 71..262 CDD:473070 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.