DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67a and Ir56b

DIOPT Version :9

Sequence 1:NP_648329.3 Gene:Ir67a / 39110 FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:451 Identity:87/451 - (19%)
Similarity:166/451 - (36%) Gaps:104/451 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 IVTLPDQFP-PRSIVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTFRW------------QRPIVQ 225
            ::..|..|. |.:.::...:....:..|...:.:..|..:|::....            ::.|:.
  Fly    11 VIRSPYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVVEQDIIS 75

  Fly   226 GERMNLILLRNMTLNGTINLAISLCGFETPSELGVFSDV----YDMEEW--YIMVPRAQEISIAD 284
            |:       .|::|:|.|         ..|.|...|.:.    |.:|..  .:|||.|.|:. ..
  Fly    76 GK-------YNLSLHGVI---------IRPEETSDFFNATQHSYPLELMTNCVMVPLAPELP-KW 123

  Fly   285 VYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMISGIMGQSFN------- 342
            :|:|...|.::...:       .|.|.:..|||: .|.|..        .|...:|:.       
  Fly   124 MYMVWPLGKYIWTCL-------FLGTFYVALLLR-YVHWRE--------PGNATRSYTRNVLHAM 172

  Fly   343 ----MSARNTISSKVTNAT---------LFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRD 394
                .||...:|.|:.:|:         |::.|.:|:..:.:|:.....|....:.|..:..|..
  Fly   173 ALLMFSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIH 237

  Fly   395 SPVTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRMGLNRSNAFSALTSEWMIVAKRQ 459
            |.:.:...::               :.::|.:...  |.||....:||.|:......|:...::|
  Fly   238 SRLRIVIHDS---------------LLEELRWLPV--YQALLASPSRSYAYVVTQDAWLFFNRQQ 285

  Fly   460 ELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMG 524
            ::..||.|.:.   :|....:..:|.|.||:.:.|.:|..|..|..||:..||:....|.....|
  Fly   286 KVLIQPYFHLS---KVCFGGLFNALPMASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAG 347

  Fly   525 MISQ-KDPFPYVAFR-EFKVGDLFWIWLLWVSFLFMSFVIFLCELLVDCFISKTLIRNKRP 583
            .... .|.:|..... ||    ....|::..:.:.:|.:.|..||    ||.:.  :.:||
  Fly   348 YAKVFLDTYPVEPLNLEF----FTTAWIVLSAGIPISSLAFCLEL----FIHRR--KQRRP 398



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.