DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or98b

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:356 Identity:70/356 - (19%)
Similarity:129/356 - (36%) Gaps:53/356 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DDFLRLAVKFYNTLGID---PYETGRKRTIWFQIYFALNMFN---MVFSFYAEVATLVDRLRDNE 74
            |.||||....:..||::   ..:.|. |..|..|...|::.:   :..:|..:....|::|.|: 
  Fly     4 DKFLRLQSALFRLLGLELLHEQDVGH-RYPWRSICCILSVASFMPLTIAFGLQNVQNVEQLTDS- 66

  Fly    75 NFLESCILLSYVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPSAKVQEEYAVKSWLKRCHI 139
                    |..|...::.|.|||..:........|:.|......:.:.....|..|....:|...
  Fly    67 --------LCSVLVDLLALCKIGLFLWLYKDFKFLIGQFYCVLQTETHTAVAEMIVTRESRRDQF 123

  Fly   140 YTKGFGGLFMIMYFAHALI-PLFIYFIQRVLLHYPDAKQI---MPFYQLEPWEFRDSWLFYPSYF 200
            .:..:...|:....:..|: ||      .:|:.|....::   .||..:.||:......:..|||
  Fly   124 ISAMYAYCFITAGLSACLMSPL------SMLISYQRTGELQPKFPFPSVYPWDNMKLSNYIISYF 182

  Fly   201 HQSSAGYTATCGSIAGDLM----------IFAVVLQVIMHYERLAKVLREFKIQAHNAPNGAKED 255
            ....|.......::..|.:          :|.:....:||:|                ....||.
  Fly   183 WNVCAALGVALPTVCVDTLFCSLSHNLCALFQIARHKMMHFE----------------GRNTKET 231

  Fly   256 IRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASALLVCLVGVQLTIALSPEYFCKQMLFLIS 320
            ...|:.:...:...|.|...:||.|. ||:..|:|::|.:|::..||:..:..........|..:
  Fly   232 HENLKHVFQLYALCLNLGHFLNEYFR-PLICQFVAASLHLCVLCYQLSANILQPALLFYAAFTAA 295

  Fly   321 VLLEVYLLCSFSQRLIDASENVGHAAYDMDW 351
            |:.:|.:.|.....:....:..|.|.|:..|
  Fly   296 VVGQVSIYCFCGSSIHSECQLFGQAIYESSW 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 54/291 (19%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 57/300 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.