DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or98a

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:374 Identity:69/374 - (18%)
Similarity:136/374 - (36%) Gaps:91/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 WFQIYFALNMFNMVFSFYAEVATLV--DRLRDNENFLESCILLSYVSFVVMGLSKIGAVMKKKPK 105
            |..:|..:   .::.||..::.|..  :.|...:.|..|..:...|.|..:.:|   ...|.|..
  Fly    53 WCAVYLPI---GIIISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFFNLYIS---GFYKAKKL 111

  Fly   106 MTALVRQLETCFPSPSAKVQEEYAVKSWLKRCHIYTKGFGGLFMIMYFAHALIPLFIYFIQRVLL 170
            ::.:.::..|        ::|...|...:.||:   |.:            ||..|||       
  Fly   112 LSEMDKRCTT--------LKERVEVHQGVVRCN---KAY------------LIYQFIY------- 146

  Fly   171 HYPDAKQIMPFYQLE-----PW-------EFRDSWLFYPSYFHQSSAGYTATCGSIAGDLMIFAV 223
               .|..|..|....     ||       :||:|    .|.|.:::...||        ||:|||
  Fly   147 ---TAYTISTFLSAALSGKLPWRIYNPFVDFRES----RSSFWKAALNETA--------LMLFAV 196

  Fly   224 VLQVIMH------YERLAKV-LREFKIQAHN-APNGAKEDIRKLQSL---VANHIDILRLTDLMN 277
            . |.:|.      |..:.:| |:..:::..: ..:..|.|....|.|   :.:|..|:.....:.
  Fly   197 T-QTLMSDIYPLLYGLILRVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNLIIDYAAAIR 260

  Fly   278 EVFGIPLLLNFIASALLVCLVGVQLTIALSPEYF-------CKQMLFLISVLLEVYLLCSFSQRL 335
            ......:.:.|:       |:|:.|.:::....|       ...:.::..::::.:..|.....|
  Fly   261 PAVTRTIFVQFL-------LIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFPFCFVCDLL 318

  Fly   336 IDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLS 384
            ....|.:..|.:..:|:.|.:.:|..|.:....:||.:...|..:..:|
  Fly   319 KKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPIS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 63/340 (19%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 64/350 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.