DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or71a

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:272 Identity:59/272 - (21%)
Similarity:125/272 - (45%) Gaps:25/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 FGGLFMIMYFAHA-LIPLFIYFIQRVLLHYPDAKQIMPFYQLEPWEFRDSWLFYPSYFHQSSAGY 207
            |..:||......| :||..:  ||.:.    |....:||:...|::::...||:.::.:|::...
  Fly   124 FNRVFMFYCLCSAGVIPFIV--IQPLF----DIPNRLPFWMWTPFDWQQPVLFWYAFIYQATTIP 182

  Fly   208 TATCGSIAGDLMIFAVVLQVIMHYERLAKVL--REFKIQAHNAPNGAKEDIR-KLQSLVANHIDI 269
            .|...::..|    ||...:::|.....::|  |..|:| |:     .:|:| |...|:..| ..
  Fly   183 IACACNVTMD----AVNWYLMLHLSLCLRMLGQRLSKLQ-HD-----DKDLREKFLELIHLH-QR 236

  Fly   270 LRLTDLMNEVF-GIPLLLNFIASALLVC--LVGVQLTIALSP-EYFCKQMLFLISVLLEVYLLCS 330
            |:...|..|:| ........:.|:|::|  :..:|::..|.. ..|...|.:|::::::|.|...
  Fly   237 LKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPTI 301

  Fly   331 FSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLSMPTMSIFLGMS 395
            :...:||::..:..:.|:.||...:.|.:::::...:...:||.|||.....:.:|..:..:..:
  Fly   302 YGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQA 366

  Fly   396 YKFFCAVRTMYQ 407
            |.....:..|.|
  Fly   367 YSLLALLLNMNQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 56/259 (22%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 56/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.