DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or67d

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_648390.2 Gene:Or67d / 39191 FlyBaseID:FBgn0036080 Length:391 Species:Drosophila melanogaster


Alignment Length:406 Identity:89/406 - (21%)
Similarity:152/406 - (37%) Gaps:69/406 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PEEKYVEVDDFLRLAVKFYNTLGIDPYETGRKRTIWFQIYFALNMFNMVFSFYAEVATLVDRLRD 72
            |.|:|.:|...:|..|.|......||     ...:|:..|..  |..:.|.|.....|:...:..
  Fly     9 PVERYCKVIRMIRFCVGFCGNDVADP-----NFRMWWLTYAV--MAAIAFFFACTGYTIYVGVVI 66

  Fly    73 NENFLESCILLSYVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPSAKVQEEYAVKSWLKRC 137
            |.:.......|:.|...|.||:|:.........|..:....|..:....:| .:||| |...||.
  Fly    67 NGDLTIILQALAMVGSAVQGLTKLLVTANNASHMREVQNTYEDIYREYGSK-GDEYA-KCLEKRI 129

  Fly   138 HI-YTK--GFGGLFMIMYFAHALIPLFIYFI--QRVLLHYPDAKQIMPFYQLEPWEFRDSWLFYP 197
            .| :|.  ||..:::|:.......|:|...|  |:||        :|.|             ..|
  Fly   130 RITWTLLIGFMLVYIILLGLVITFPIFYLLILHQKVL--------VMQF-------------LIP 173

  Fly   198 SYFHQSSAGY---TAT---------CGSIAGDLMIFAVVLQVIMHYERLAKVLREFKIQAHNAPN 250
            ...|.:..|:   ||.         .|:..||:.:|..|..|.:..:.....|.||     |...
  Fly   174 FLDHTTDGGHLILTAAHVILITFGGFGNYGGDMYLFLFVTHVPLIKDIFCVKLTEF-----NELV 233

  Fly   251 GAKEDIRKLQSLVAN----HIDILRLTDLMNEVFGIPLLLNFIASALLVCLVGVQLTIALSPEYF 311
            ..:.|..|:::::.:    |....|:.....:::.|.|.:.     |....||:..||:.   .|
  Fly   234 MKRNDFPKVRAMLCDLLVWHQLYTRMLQTTKKIYSIVLFVQ-----LSTTCVGLLCTISC---IF 290

  Fly   312 CKQM----LFLISVLLEVYLLCSFSQRLIDASENVGHAAY-DMDWLGSDKRFKKILIFISMRSQK 371
            .|..    |:|:...:.:|..|.....:.:::|:.....| :..|.....:.:|::|.:..::|.
  Fly   291 MKAWPAAPLYLLYAAITLYTFCGLGTLVENSNEDFLSVIYTNCLWYELPVKEEKLIIMMLAKAQN 355

  Fly   372 PVCLKATVVLDLSMPT 387
            .|.|.|..:..|||.|
  Fly   356 EVVLTAADMAPLSMNT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 73/339 (22%)
Or67dNP_648390.2 7tm_6 69..380 CDD:251636 73/339 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.