DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or59c

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:428 Identity:75/428 - (17%)
Similarity:148/428 - (34%) Gaps:136/428 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DDFLRLAVKFYNTLGIDP---------YETGRKRTIWFQI-YFALNM-FNMVFSFYAEVATLVDR 69
            |.:.|:|  |:  ||..|         |......|:|..| |..|.: ...|..|        ||
  Fly    25 DYYYRIA--FF--LGWTPPKGALLRWIYSLWTLTTMWLGIVYLPLGLSLTYVKHF--------DR 77

  Fly    70 LRDNE-------------NFLESCILLSYVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPS 121
            ....|             |.::||:..|.              |.:..:|..|:..|:       
  Fly    78 FTPTEFLTSLQVDINCIGNVIKSCVTYSQ--------------MWRFRRMNELISSLD------- 121

  Fly   122 AKVQEEYAVKSWLKRC------HIYTKGFGG------LFMIMYFAHALIPLFIYFIQRVLLHYPD 174
                         |||      .|:.|....      ||:..|.....:.||             
  Fly   122 -------------KRCVTTTQRRIFHKMVARVNLIVILFLSTYLGFCFLTLF------------- 160

  Fly   175 AKQIMPFYQLEPWEF--------RDSWLFYPSYFHQSSAGYTATCGSIAGD------LMIFAVVL 225
               ...|....||:.        :..|..:.:...:.......|...:..|      :.:|...|
  Fly   161 ---TSVFAGKAPWQLYNPLVDWRKGHWQLWIASILEYCVVSIGTMQELMSDTYAIVFISLFRCHL 222

  Fly   226 QVIMHYERLAKVLREFKIQAHNAPNGAKEDIRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIA 290
            .::.  :|:|.:.::.|:       ...|...::.:.:.:|..|::.:.::..:..|.:...|: 
  Fly   223 AILR--DRIANLRQDPKL-------SEMEHYEQMVACIQDHRTIIQCSQIIRPILSITIFAQFM- 277

  Fly   291 SALLVCLVGVQLTI-ALSPEYF-------CKQMLFLISVLLEVYLLCSFSQRLIDASENVGHAAY 347
                  |||:.|.: |:|..:|       ...:.|::::..|.:..|...:.||:.|.:|.:|.:
  Fly   278 ------LVGIDLGLAAISILFFPNTIWTIMANVSFIVAICTESFPCCMLCEHLIEDSVHVSNALF 336

  Fly   348 DMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLSM 385
            ..:|:.:|:.:|..:::...|:|:|:...|..:..:|:
  Fly   337 HSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 57/345 (17%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 58/362 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.