DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or49a

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:412 Identity:105/412 - (25%)
Similarity:187/412 - (45%) Gaps:40/412 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EKYVEVDDFLRLAVKFYNTLGIDPYETGRKRTIWFQIYFALNMFNM--VFSFYAEVATLVDRLRD 72
            ||....:||:.:|...:.|||.|.:.|.:.   |::.......|.:  :.:|| |.:.:..|:.:
  Fly     2 EKLRSYEDFIFMANMMFKTLGYDLFHTPKP---WWRYLLVRGYFVLCTISNFY-EASMVTTRIIE 62

  Fly    73 NENFL--ESCILLSYVSFVVMGLSKIGAV--MKKKPKMTALVRQLETCFPSPSAKVQEEYAVKSW 133
            .|:..  .|.|:...:.|..|..|::..:  |..:.::..|..:|:..:|..... |.:|.|..:
  Fly    63 WESLAGSPSKIMRQGLHFFYMLSSQLKFITFMINRKRLLQLSHRLKELYPHKEQN-QRKYEVNKY 126

  Fly   134 LKRCHIYTKGFGGLFMIMYFAHALIPLFIYFIQRVLLH---YPDA----KQIMP----FYQLEPW 187
            ...|.  |:....::..:....||.||    :|..:::   :..|    |:|.|    |...:|.
  Fly   127 YLSCS--TRNVLYVYYFVMVVMALEPL----VQSCIMYLIGFGKADFTYKRIFPTRLTFDSEKPL 185

  Fly   188 EFRDSWLFYPSYFHQSSAGYTATCGSIAGDLMIFAVVLQVIMHYERLAKVLREFKIQAHNAPNGA 252
            .:   .|.|...|..|......:.|:   ||.:..|..|:.||...||.:|...:    .:|...
  Fly   186 GY---VLAYVIDFTYSQFIVNVSLGT---DLWMMCVSSQISMHLGYLANMLASIR----PSPETE 240

  Fly   253 KEDIRKLQSLVANHIDILRLTDLMNEVFGIPLLLN-FIASALLVCLVGVQLTIALSPEYFCKQML 316
            ::|...|.|::..|..::||...:|.|||:.|..| |..|.||.|:....:....:.|.....||
  Fly   241 QQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGISYMML 305

  Fly   317 FLISVLLEVYLLCSFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVL 381
            | .||..:.|::.|..|.|||.|.|:..||::..|.....|:||.::.:..::|:|:.:.|..|:
  Fly   306 F-ASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILILMAQAQRPLEISARGVI 369

  Fly   382 DLSMPTMSIFLGMSYKFFCAVR 403
            .:|:.|..|.:.::|:||..:|
  Fly   370 IISLDTFKILMTITYRFFAVIR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 84/336 (25%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 79/313 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472782
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EMAZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.