DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or24a

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:441 Identity:92/441 - (20%)
Similarity:164/441 - (37%) Gaps:130/441 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AEMPEEK-YVEVDDFLRLAVKFYNTLGIDPYETGRKRTIWFQIYFALNMFNMVFSFYAE------ 62
            |..|.|: |..|..|....:.||         ..:|||:..:::...|.|.:.:..|||      
  Fly     8 ASYPMERHYFMVPKFALSLIGFY---------PEQKRTVLVKLWSFFNFFILTYGCYAEAYYGIH 63

  Fly    63 -----VATLVDRLRDNENFLESCILLSYVSFVVMGLSKIGAV--------------------MKK 102
                 :||.:|.|         |.:.|    .::.|.|:.|:                    .|.
  Fly    64 YIPINIATALDAL---------CPVAS----SILSLVKMVAIWWYQDELRSLIERVRFLTEQQKS 115

  Fly   103 KPKM----------TALVRQLETCFPSPSAKVQEEYAVKSWLKRCH----IYTKGFGGLFMIMYF 153
            |.|:          |.|...|..|....|......:.:.:.|:|.|    ||...|.     |.|
  Fly   116 KRKLGYKKRFYTLATQLTFLLLCCGFCTSTSYSVRHLIDNILRRTHGKDWIYETPFK-----MMF 175

  Fly   154 AHALIPLFIYFIQRVLLHYPDAKQIMPFYQLEPWEFRDSWLFYPSYFHQSSAGY-TATC-----G 212
            ...|:.|.:|.|..:|:|               |.                 || |..|     |
  Fly   176 PDLLLRLPLYPITYILVH---------------WH-----------------GYITVVCFVGADG 208

  Fly   213 SIAGDLMIFAVVLQVIMHYERLAKVLREFKIQAHNAPNGAKED--IRKLQSLVANHIDILRLTDL 275
            ...|..:.|.|:|..:.  :.:..:|....|:  .:|:.|:|.  :|:::.||..|.::..||:.
  Fly   209 FFLGFCLYFTVLLLCLQ--DDVCDLLEVENIE--KSPSEAEEARIVREMEKLVDRHNEVAELTER 269

  Fly   276 MNEVFGIPLLLNFIASALLV--CLVGVQLTIALSPEYFCKQMLFLISVLLEVYLLCSFSQRLIDA 338
            ::.|.....|.:|:.|:|::  .:|.:.|...|.   ....:::..:|.:|::|.|.....:::|
  Fly   270 LSGVMVEITLAHFVTSSLIIGTSVVDILLFSGLG---IIVYVVYTCAVGVEIFLYCLGGSHIMEA 331

  Fly   339 SENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLSMPTMS 389
            ..|:..:.:...|.|...|.:|:.:.:..|:|:        ||.:.:|..|
  Fly   332 CSNLARSTFSSHWYGHSVRVQKMTLLMVARAQR--------VLTIKIPFFS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 72/359 (20%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 76/372 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.