DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or22a

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_523453.1 Gene:Or22a / 33335 FlyBaseID:FBgn0026398 Length:397 Species:Drosophila melanogaster


Alignment Length:448 Identity:84/448 - (18%)
Similarity:161/448 - (35%) Gaps:114/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NVAEMP-EEKYVEVDDFLRLAVKFY--------NTLGIDPYETGRKRTIWFQIYFALNMFNMVFS 58
            ::.|.| .|:....|.|:.|....:        |...|.||:      :|      |...|:|..
  Fly     8 HIKEKPLSERVKSRDAFIYLDRVMWSFGWTEPENKRWILPYK------LW------LAFVNIVML 60

  Fly    59 FYAEVATLVDRLRDNENFLESCILLSYVSFVVMGLSKIGAV---------MKKKPKMTALVRQLE 114
            ....::..::.|...:.|...    .::|.:.:|::..|:.         .||:.:...|:.||:
  Fly    61 ILLPISISIEYLHRFKTFSAG----EFLSSLEIGVNMYGSSFKCAFTLIGFKKRQEAKVLLDQLD 121

  Fly   115 TCFPSPSAKVQEEYAVKSWLKRC---------HIYTKGFGGLFMIMYFAHALIPLFIYFIQRVLL 170
                                |||         |.|. ..|..|.|:|        .|::...|::
  Fly   122 --------------------KRCLSDKERSTVHRYV-AMGNFFDILY--------HIFYSTFVVM 157

  Fly   171 HYPDAKQIMPFYQLEPWEFRDSWLFYPSYFHQSSAGYTATCG-----------SIAGDLMIFAVV 224
            ::       |::.||.   |.:|..|..|.......|.::..           .:..|:.....:
  Fly   158 NF-------PYFLLER---RHAWRMYFPYIDSDEQFYISSIAECFLMTEAIYMDLCTDVCPLISM 212

  Fly   225 LQVIMHYERLAKVLREFKIQAHNAPNGAKED--IRKLQSLVANHIDILRLTDLMNEVFGIPLLLN 287
            |....|...|.:.||..:     :..|..||  :.:|...:.:|..:|...|.:..||...:.:.
  Fly   213 LMARCHISLLKQRLRNLR-----SKPGRTEDEYLEELTECIRDHRLLLDYVDALRPVFSGTIFVQ 272

  Fly   288 FIASALLVCLVGVQLTIALSPEYFCKQM-------LFLISVLLEVYLLCSFSQRLIDASENVGHA 345
            |:       |:|..|.:::....|....       ||:..|.:|.:..|.....:||..:.:.:.
  Fly   273 FL-------LIGTVLGLSMINLMFFSTFWTGVATCLFMFDVSMETFPFCYLCNMIIDDCQEMSNC 330

  Fly   346 AYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLSMPTMSIFLGMSYKFFCAVR 403
            .:..||..:|:|:|..|::.....|:|:.|.|..|..:||.|....:.:::.....::
  Fly   331 LFQSDWTSADRRYKSTLVYFLHNLQQPITLTAGGVFPISMQTNLAMVKLAFSVVTVIK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 69/358 (19%)
Or22aNP_523453.1 7tm_6 81..381 CDD:251636 68/354 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466006
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.