DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or69a

DIOPT Version :9

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:421 Identity:93/421 - (22%)
Similarity:180/421 - (42%) Gaps:57/421 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VEVDDFLRLAVKFYNTLGIDPYE-TGR-----KRTIWFQIYFALNMFNMVFSFYAEVATLV---- 67
            ::::||:|..........:..|. .||     ||.:..:|.|.|...|:|   |..:..::    
  Fly     1 MQLEDFMRYPDLVCQAAQLPRYTWNGRRSLEVKRNLAKRIIFWLGAVNLV---YHNIGCVMYGYF 62

  Fly    68 --DRLRDNENFL-ESCILLSYVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPSAKVQEEYA 129
              .|.:|...:| |...:.|.:.|.::|...:..::..|.....|:.:.|..|          ..
  Fly    63 GDGRTKDPIAYLAELASVASMLGFTIVGTLNLWKMLSLKTHFENLLNEFEELF----------QL 117

  Fly   130 VKSWLKRCHIYTKGFGGLFMIMYFAHALIPLFIYFIQRVLL---HYPDAKQIMPFYQLE-----P 186
            :|....|.|.|.:.:.......:..|....::...:..:|:   |:.:::|:  .|:::     |
  Fly   118 IKHRAYRIHHYQEKYTRHIRNTFIFHTSAVVYYNSLPILLMIREHFSNSQQL--GYRIQSNTWYP 180

  Fly   187 WEFRDSWLFYPSYFH----QSSAGYTATCGSIAGDLMIFAVVLQVIMHYERLAKVLREFKIQAHN 247
            |:.:.|   .|.:|.    |..:..|..|.::....:|....:|:.:|::.||:.|.  .|.|.|
  Fly   181 WQVQGS---IPGFFAAVACQIFSCQTNMCVNMFIQFLINFFGIQLEIHFDGLARQLE--TIDARN 240

  Fly   248 APNGAKEDIRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASALLVCLVGVQLTIALSPEYFC 312
             |: ||:   :|:.|:..|..:|.|.|.:|..|....|::...|.:..|.:...:|:.    .|.
  Fly   241 -PH-AKD---QLKYLIVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMF----DFG 296

  Fly   313 KQMLFLISVLLEV---YLLCSFSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVC 374
            ..:..|:.:||.:   :.:|.....||..|..|..||:..:|...|..::::|:.:.||:.||..
  Fly   297 TSLKHLLGLLLFITYNFSMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYM 361

  Fly   375 LKATVVLDLSMPTMSIFLGMSYKFFCAVRTM 405
            .|...:..:|:.|....|..||:.|..||::
  Fly   362 WKTYKLAPVSITTYMATLKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 72/336 (21%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 72/334 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D407395at33208
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.