DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and IMP3

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_012018.1 Gene:IMP3 / 856553 SGDID:S000001191 Length:183 Species:Saccharomyces cerevisiae


Alignment Length:157 Identity:36/157 - (22%)
Similarity:73/157 - (46%) Gaps:9/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESR 92
            ::.:::..|.::|:.:..:.......||:.|.:|..|...|..|......||.:|..:|||....
Yeast    28 RDTQVMRTYHIQNREDYHKYNRICGDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKS 92

  Fly    93 MKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKH 157
            ...|....:.:.....|||...:.:|.:|::|..|...|.|.|:||...::|.|:::|..:.:.:
Yeast    93 KISDLENKVTVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDY 157

  Fly   158 IDFSLKSPFGGGRPGRVKRKNLK-KNQ 183
            :.:...|        ::|:..|: :||
Yeast   158 VTWVDNS--------KIKKTLLRYRNQ 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 34/154 (22%)
IMP3NP_012018.1 RpsD 1..>177 CDD:223596 36/157 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.