DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and RPS9A

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_015244.1 Gene:RPS9A / 856024 SGDID:S000006002 Length:197 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:130/191 - (68%)
Similarity:160/191 - (83%) Gaps:0/191 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDE 69
            |.|..:||||.||:||||.:|||.|||:.||:||:||:|::|:.:.|:|||:|||:|||.||||.
Yeast     3 RAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSKIRRAARDLLTRDEKDP 67

  Fly    70 KRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQR 134
            ||||:||||:|||||:|||.|.:.||||||.||:||||||||||||:|||||||:|||||||.||
Yeast    68 KRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAKSVHHARVLITQR 132

  Fly   135 HIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEED 195
            ||.|.||:||||||:|||||:|||||:..|||||.|||||.|:|..:.....|.||:|.::
Yeast   133 HIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNAARKAEASGEAADEADE 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 126/176 (72%)
RPS9ANP_015244.1 PTZ00155 1..181 CDD:185484 126/177 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345978
Domainoid 1 1.000 77 1.000 Domainoid score I2087
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68145
Inparanoid 1 1.050 279 1.000 Inparanoid score I563
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62206
OrthoFinder 1 1.000 - - FOG0002732
OrthoInspector 1 1.000 - - otm46775
orthoMCL 1 0.900 - - OOG6_100955
Panther 1 1.100 - - O PTHR11831
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1251
SonicParanoid 1 1.000 - - X1822
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.