DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and Rps9

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_112370.2 Gene:Rps9 / 81772 RGDID:619889 Length:194 Species:Rattus norvegicus


Alignment Length:187 Identity:164/187 - (87%)
Similarity:176/187 - (94%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLF 73
            |..|||||||||:||:|||||||:||||||||||||||||:.||||||||||||||||||.:|||
  Rat     8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLF 72

  Fly    74 QGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRV 138
            :||||||||||||||||.:|||||:||||||||||||||||||||||||||||||||||||||||
  Rat    73 EGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRV 137

  Fly   139 RKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEED 195
            ||||||||||:|||||||||||||:||:||||||||||||.||.|||.|...:||||
  Rat   138 RKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 155/172 (90%)
Rps9NP_112370.2 PTZ00155 11..177 CDD:185484 151/165 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 87 1.000 Domainoid score I7860
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68145
Inparanoid 1 1.050 332 1.000 Inparanoid score I2340
OMA 1 1.010 - - QHG62206
OrthoDB 1 1.010 - - D1310788at2759
OrthoFinder 1 1.000 - - FOG0002732
OrthoInspector 1 1.000 - - otm45355
orthoMCL 1 0.900 - - OOG6_100955
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1822
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.