DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and IMP3

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_060755.1 Gene:IMP3 / 55272 HGNCID:14497 Length:184 Species:Homo sapiens


Alignment Length:167 Identity:46/167 - (27%)
Similarity:79/167 - (47%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRM 93
            ||:::..|.|:.:.:..|.......:|:.||.|..|.|:|:.|:....|||.:|..:|:: .:|.
Human    30 ELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLV-PTRG 93

  Fly    94 KLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHI 158
            .|:....:....|..|||.|.:.||.:|:.:..|...:.|.|:||...||..|:|:|....:..:
Human    94 SLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFV 158

  Fly   159 DFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEED 195
            .:...|        ::||..|:.|        ||.:|
Human   159 TWVDSS--------KIKRHVLEYN--------EERDD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 42/152 (28%)
IMP3NP_060755.1 RpsD 1..>168 CDD:223596 39/146 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.