DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and CG4866

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_611224.1 Gene:CG4866 / 36976 FlyBaseID:FBgn0034232 Length:181 Species:Drosophila melanogaster


Alignment Length:123 Identity:29/123 - (23%)
Similarity:61/123 - (49%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESR 92
            :|.||:..:.::.:.:..:......:||:.|..:..||..:..:......||.:|..:||.:: :
  Fly    28 KENKILRRFHIQKREDYTKYNKLSREIRELAERIAKLDASEPFKTEATTMLLNKLHAMGVSND-Q 91

  Fly    93 MKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVV 150
            :.|:....:....|..|||...:.||.:::.:..|..||...|:||..:::..|:|:|
  Fly    92 LTLETAAKISASHFCRRRLPVIMVKLRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 29/123 (24%)
CG4866NP_611224.1 RpsD 1..>166 CDD:223596 29/123 (24%)
S4 108..154 CDD:279780 14/42 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0522
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11831
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.