DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and rps901

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_592945.1 Gene:rps901 / 2542629 PomBaseID:SPAC24H6.07 Length:191 Species:Schizosaccharomyces pombe


Alignment Length:187 Identity:144/187 - (77%)
Similarity:163/187 - (87%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKR 71
            |...||||..||||:|.||||.|||:.||||||||.|:|||...|:|||:||||||||||||.||
pombe     5 PRKQSKTYKVPRRPFESARLDAELKLAGEYGLRNKHEIWRVALTLSKIRRAARELLTLDEKDPKR 69

  Fly    72 LFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHI 136
            ||:|||::|||||:|:|||:||||||||.|:|||||||||||||||||||||||||||||.||||
pombe    70 LFEGNAIIRRLVRLGILDETRMKLDYVLALRIEDFLERRLQTQVFKLGLAKSIHHARVLIFQRHI 134

  Fly   137 RVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEE 193
            ||.||:||:||||||||:||||||:|.||:|||||||.|||.|:..:||.|..||||
pombe   135 RVGKQIVNVPSFVVRLDTQKHIDFALSSPYGGGRPGRCKRKRLRSQEGGEGEEAEEE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 137/174 (79%)
rps901NP_592945.1 PTZ00155 1..180 CDD:185484 137/174 (79%)
NADB_Rossmann <63..>161 CDD:304358 82/97 (85%)
S4 107..149 CDD:279780 37/41 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2309
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68145
Inparanoid 1 1.050 295 1.000 Inparanoid score I621
OMA 1 1.010 - - QHG62206
OrthoFinder 1 1.000 - - FOG0002732
OrthoInspector 1 1.000 - - otm47227
orthoMCL 1 0.900 - - OOG6_100955
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1251
SonicParanoid 1 1.000 - - X1822
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.