DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and rps-9

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_496384.1 Gene:rps-9 / 174699 WormBaseID:WBGene00004478 Length:189 Species:Caenorhabditis elegans


Alignment Length:190 Identity:146/190 - (76%)
Similarity:173/190 - (91%) Gaps:3/190 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDE 69
            |:.:|.||...:||||:||.|||||||:||.:||:||||||||||.|||:||||||||||::||.
 Worm     3 RLKTVQSKVTKSPRRPFEKERLDQELKLIGTFGLKNKREVWRVKYTLAKVRKAARELLTLEDKDP 67

  Fly    70 KRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQR 134
            ||||:|||||||||:||||||::||||||||||:|||||||||||||||||||||||||:||:|.
 Worm    68 KRLFEGNALLRRLVKIGVLDETKMKLDYVLGLKVEDFLERRLQTQVFKLGLAKSIHHARILIKQH 132

  Fly   135 HIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEE 194
            |||||:|||::|||:|||||||||||||:||:||||||||||:.|:|..|.||   ::||
 Worm   133 HIRVRRQVVDVPSFIVRLDSQKHIDFSLQSPYGGGRPGRVKRRTLRKGDGAGG---DDEE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 140/176 (80%)
rps-9NP_496384.1 PTZ00155 1..179 CDD:185484 140/175 (80%)
S4 107..149 CDD:279780 34/41 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166117
Domainoid 1 1.000 82 1.000 Domainoid score I5451
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68145
Inparanoid 1 1.050 301 1.000 Inparanoid score I1624
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62206
OrthoDB 1 1.010 - - D1310788at2759
OrthoFinder 1 1.000 - - FOG0002732
OrthoInspector 1 1.000 - - oto19913
orthoMCL 1 0.900 - - OOG6_100955
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1251
SonicParanoid 1 1.000 - - X1822
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.