DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and C48B6.2

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_491972.1 Gene:C48B6.2 / 172420 WormBaseID:WBGene00016740 Length:183 Species:Caenorhabditis elegans


Alignment Length:153 Identity:42/153 - (27%)
Similarity:71/153 - (46%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RLDQELKIIGEYG--LR----NKREVWRVKYAL-----AKIRKAARELLTLDEKDEKRLFQGNAL 78
            ::||:    |:.|  ||    .|||    .|||     ||.|:.|..:..|.|.|..|......:
 Worm    22 QVDQQ----GKQGDMLRKFYVKKRE----HYALYNTLAAKSREVADLIKNLSESDPFRSKCTEDM 78

  Fly    79 LRRLVRIGVL--DESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQ 141
            |.:....|::  .::..::..|.|   ..|..|||...:..:|:.:|:..|..|:.|.|:|:..:
 Worm    79 LTKFYAAGLVPTSDTLERIGKVTG---ASFARRRLPVVMRNIGMCESVKTASDLVEQGHVRIGTK 140

  Fly   142 VVNIPSFVVRLDSQKHIDFSLKS 164
            :|..|:|:|...|:..|.::..|
 Worm   141 LVTDPAFMVTRSSEDMITWTKAS 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 42/153 (27%)
C48B6.2NP_491972.1 RpsD 1..>167 CDD:223596 42/153 (27%)
S4 108..157 CDD:279780 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0522
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.