DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and rps9

DIOPT Version :9

Sequence 1:NP_001287008.1 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_957146.1 Gene:rps9 / 114420 ZFINID:ZDB-GENE-010724-15 Length:194 Species:Danio rerio


Alignment Length:187 Identity:167/187 - (89%)
Similarity:179/187 - (95%) Gaps:0/187 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLF 73
            |.||||||||||:||:||||||::||||||||||||||||:.||||||||||||||||||.||||
Zfish     8 VCSKTYVTPRRPFEKSRLDQELRLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLF 72

  Fly    74 QGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRV 138
            :||||||||||||||||.:|||||:||||:|||||||||||||||||||||||||||||||||||
Zfish    73 EGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRV 137

  Fly   139 RKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEED 195
            ||||||||||||||||||||||||:||:||||||||||||.||.||||||..:||||
Zfish   138 RKQVVNIPSFVVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKAQGGGGGGDDEEED 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_001287008.1 PTZ00155 4..182 CDD:185484 156/172 (91%)
rps9NP_957146.1 PTZ00155 10..181 CDD:185484 155/170 (91%)
S4 108..150 CDD:279780 41/41 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594401
Domainoid 1 1.000 87 1.000 Domainoid score I8013
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68145
Inparanoid 1 1.050 338 1.000 Inparanoid score I2353
OMA 1 1.010 - - QHG62206
OrthoDB 1 1.010 - - D1310788at2759
OrthoFinder 1 1.000 - - FOG0002732
OrthoInspector 1 1.000 - - oto40532
orthoMCL 1 0.900 - - OOG6_100955
Panther 1 1.100 - - LDO PTHR11831
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1251
SonicParanoid 1 1.000 - - X1822
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.