DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS9 and Imp3

DIOPT Version :10

Sequence 1:NP_524004.2 Gene:RpS9 / 39108 FlyBaseID:FBgn0010408 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_598737.1 Gene:Imp3 / 102462 MGIID:1916119 Length:184 Species:Mus musculus


Alignment Length:167 Identity:47/167 - (28%)
Similarity:78/167 - (46%) Gaps:17/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRM 93
            ||:::..|.|:.:.|..|.......:|:.||.|..|.|:|..|:....|||.:|..:|:: .:|.
Mouse    30 ELRVLRRYRLQRREEYTRYNQLSRAVRELARRLRDLPERDPFRVRASAALLDKLYAMGLV-PTRG 93

  Fly    94 KLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHI 158
            .|:....:....|..|||.|.:.||.:|:.:..|...:.|.|:||...||..|:|:|....:..:
Mouse    94 SLELCDSVSASSFCRRRLPTLLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFV 158

  Fly   159 DFSLKSPFGGGRPGRVKRKNLKKNQGGGGGAAEEEED 195
            .:...|        ::||..|:.|        ||.:|
Mouse   159 TWVDSS--------KIKRHVLEYN--------EERDD 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS9NP_524004.2 PTZ00155 4..182 CDD:185484 43/152 (28%)
Imp3NP_598737.1 uS4_arch 30..167 CDD:273397 40/145 (28%)

Return to query results.
Submit another query.