Sequence 1: | NP_648328.1 | Gene: | CG3408 / 39107 | FlyBaseID: | FBgn0036008 | Length: | 331 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_194335.2 | Gene: | PIRL8 / 828711 | AraportID: | AT4G26050 | Length: | 383 | Species: | Arabidopsis thaliana |
Alignment Length: | 203 | Identity: | 50/203 - (24%) |
---|---|---|---|
Similarity: | 81/203 - (39%) | Gaps: | 40/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 ETCDLSLSELSEIPVREIASFKRVTVLDLSSNRLVNLGKNFSILTRLVRLDLSKNQIKFLPEDF- 84
Fly 85 ------------------------GQLEQLRHLDLYNNCLEHLPISFGQLRRLRYLDLKGNPL-T 124
Fly 125 PAWEKIVGCCSTQKDCQQAAKNTVSICANYKPEFIERERLAAQESQKMAGAGDSSANAVQTNGGA 189
Fly 190 AGGKKSTK 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3408 | NP_648328.1 | LRR_RI | <43..>124 | CDD:238064 | 36/106 (34%) |
leucine-rich repeat | 44..66 | CDD:275378 | 9/21 (43%) | ||
LRR_8 | 65..123 | CDD:290566 | 25/82 (30%) | ||
leucine-rich repeat | 67..89 | CDD:275378 | 10/46 (22%) | ||
leucine-rich repeat | 90..112 | CDD:275378 | 9/21 (43%) | ||
leucine-rich repeat | 113..124 | CDD:275378 | 5/11 (45%) | ||
PIRL8 | NP_194335.2 | PRK15370 | <81..>308 | CDD:185268 | 44/168 (26%) |
leucine-rich repeat | 84..105 | CDD:275380 | |||
leucine-rich repeat | 106..128 | CDD:275380 | |||
leucine-rich repeat | 129..151 | CDD:275380 | |||
leucine-rich repeat | 152..175 | CDD:275380 | 4/21 (19%) | ||
leucine-rich repeat | 176..198 | CDD:275380 | 9/21 (43%) | ||
leucine-rich repeat | 199..221 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 222..246 | CDD:275380 | 2/23 (9%) | ||
leucine-rich repeat | 247..269 | CDD:275380 | 9/21 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |