DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3408 and PIRL8

DIOPT Version :9

Sequence 1:NP_648328.1 Gene:CG3408 / 39107 FlyBaseID:FBgn0036008 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_194335.2 Gene:PIRL8 / 828711 AraportID:AT4G26050 Length:383 Species:Arabidopsis thaliana


Alignment Length:203 Identity:50/203 - (24%)
Similarity:81/203 - (39%) Gaps:40/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ETCDLSLSELSEIPVREIASFKRVTVLDLSSNRLVNLGKNFSILTRLVRLDLSKNQIKFLPEDF- 84
            |..:.:.:||:.:|.........:|.|.::||:||.|..:.|.||.|..||...|::..||||. 
plant   153 EELNANFNELTRLPDAIGFELTNLTKLSVNSNKLVLLPNSVSYLTSLRVLDARLNRLSSLPEDLE 217

  Fly    85 ------------------------GQLEQLRHLDLYNNCLEHLPISFGQLRRLRYLDLKGNPL-T 124
                                    |.|..|..||:..|.:..||.|.|.|||::.|.::|||| :
plant   218 NLVNLQVLNVSQNFQHLTTLPYSVGLLISLVELDVSYNGITVLPDSLGCLRRIQKLSVEGNPLIS 282

  Fly   125 PAWEKIVGCCSTQKDCQQAAKNTVSICANYKPEFIERERLAAQESQKMAGAGDSSANAVQTNGGA 189
            |.:|.:              :..:.....|..|.:..........:|..|.|......:.::.|.
plant   283 PPFEVV--------------EQGLEALKQYMSEKMTESYKKTPTKKKSWGIGKLVKYGLSSSPGR 333

  Fly   190 AGGKKSTK 197
            :.|::..|
plant   334 STGREDGK 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3408NP_648328.1 LRR_RI <43..>124 CDD:238064 36/106 (34%)
leucine-rich repeat 44..66 CDD:275378 9/21 (43%)
LRR_8 65..123 CDD:290566 25/82 (30%)
leucine-rich repeat 67..89 CDD:275378 10/46 (22%)
leucine-rich repeat 90..112 CDD:275378 9/21 (43%)
leucine-rich repeat 113..124 CDD:275378 5/11 (45%)
PIRL8NP_194335.2 PRK15370 <81..>308 CDD:185268 44/168 (26%)
leucine-rich repeat 84..105 CDD:275380
leucine-rich repeat 106..128 CDD:275380
leucine-rich repeat 129..151 CDD:275380
leucine-rich repeat 152..175 CDD:275380 4/21 (19%)
leucine-rich repeat 176..198 CDD:275380 9/21 (43%)
leucine-rich repeat 199..221 CDD:275380 8/21 (38%)
leucine-rich repeat 222..246 CDD:275380 2/23 (9%)
leucine-rich repeat 247..269 CDD:275380 9/21 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.