DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment path and AT3G09340

DIOPT Version :9

Sequence 1:NP_001261634.1 Gene:path / 39106 FlyBaseID:FBgn0036007 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_187545.2 Gene:AT3G09340 / 820090 AraportID:AT3G09340 Length:528 Species:Arabidopsis thaliana


Alignment Length:418 Identity:94/418 - (22%)
Similarity:169/418 - (40%) Gaps:76/418 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GTGILGMPFAFMCSGLIMGIFSTIFTAFICTHCSYVLVKCGHKLYYRTRRTKMTFAEIAEAAFQK 137
            |..:|.||:|....|. :|:...:..|.|..:...:|.:|     ..:.....|:.:|.:|||  
plant   149 GISLLTMPYAVKEGGW-LGLCILLSFAIITCYTGILLKRC-----LESSSDLRTYPDIGQAAF-- 205

  Fly   138 GPKWCRGFAPVAKFSILFGLFLTYFGTCSVYTVIVASNFEQLISYWT----GTAVSLRMLICIML 198
                  ||......|||  |::..:..|..|.::::.|..::....|    |.::....:..|..
plant   206 ------GFTGRLIISIL--LYMELYVCCVEYIIMMSDNLSRVFPNITLNIVGVSLDSPQIFAISA 262

  Fly   199 VPLIL-IAWVPNLKYLAPVSMVANVFMGLGLGITFYYLVQDLPPVEERESVVWST---------L 253
            ..::| ..|:.:|..|:.:| ...||:.:.|.:..::       |...:.|.:.|         |
plant   263 TLIVLPTVWLKDLSLLSYLS-AGGVFVSILLALCLFW-------VGSVDGVGFHTGGKALDLANL 319

  Fly   254 PQFFSITIFAMEAIGVVMPLENNMKTPQSF-------LGICGVLSQGMSGVTLIYMLLGFLGYLR 311
            |....|..|......|:..:.::||.|..|       .|.|          ...|:.:...||..
plant   320 PVAIGIFGFGFSGHAVLPSIYSSMKEPSKFPLVLLISFGFC----------VFFYIAVAICGYSM 374

  Fly   312 YGSATGESITLNLPIEEWPAQTVKVLISLAVYCTFGLQFFVCLEIIWDGIKEKC----KKRPTLV 372
            :|.|.....|||:| :::.|..:.|..::.|..|   ::.:.|..|..|::|..    |.|...|
plant   375 FGEAIQSQFTLNMP-QQYTASKIAVWTAVVVPMT---KYALALTPIVLGLEELMPPSEKMRSYGV 435

  Fly   373 NYVLRTVLVTAAVVLAVAVPTIGPFMGLIGAFCFSILGLIFPVVIELIVHWESGFGKYNWILWKN 437
            :..::|:||.:.:|:|:..|.......|:|:|..:::..|||.:..|.:        ....|.|.
plant   436 SIFIKTILVLSTLVVALTFPFFAIMGALMGSFLATLVDFIFPCLCYLSI--------LKGRLSKT 492

  Fly   438 AI-----ITLCGIGALVFGTQAAIKDIV 460
            .|     |.:.||.:...||.:||..:|
plant   493 QIGICVFIIISGIVSGCCGTYSAIGRLV 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pathNP_001261634.1 SLC5-6-like_sbd 56..456 CDD:294310 91/412 (22%)
SdaC 67..445 CDD:223884 87/401 (22%)
AT3G09340NP_187545.2 SLC5-6-like_sbd 135..507 CDD:320982 89/403 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.