DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and CG13643

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001262937.1 Gene:CG13643 / 50074 FlyBaseID:FBgn0040601 Length:819 Species:Drosophila melanogaster


Alignment Length:105 Identity:39/105 - (37%)
Similarity:52/105 - (49%) Gaps:23/105 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GVDYPIY--HEVPHTHFSCHNVPATPGMYANVETGCQAYHVC---------HDGREGD------Q 103
            |..:|.|  ..:|.|.|:||: ....|.||:.||.||.:|||         |  |..:      |
  Fly    38 GRPWPTYSLQNMPKTQFTCHD-KILGGYYADPETQCQMFHVCVKLPGVGLLH--RRANPFVQQVQ 99

  Fly   104 GAKFLCTNGTIFNQKEFACDWWYNVKCEEATHFY---HLN 140
            ..:|||.|.|.|:|:...|..|.:|.|::||.||   |||
  Fly   100 DYRFLCPNTTAFDQELQICANWLDVDCDKATSFYDNGHLN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 23/64 (36%)
CG13643NP_001262937.1 CBM_14 63..126 CDD:279884 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.