DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and mtg

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_731221.2 Gene:mtg / 40970 FlyBaseID:FBgn0260386 Length:556 Species:Drosophila melanogaster


Alignment Length:134 Identity:38/134 - (28%)
Similarity:58/134 - (43%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PQHHEKKQDLNKIPGVPGVDYPIYH------------EVPHTHFSCHNVPATPGMYANVETGCQA 91
            ||....:..::|:...|...||:.:            ::|.|.|||......||:||:.:.||..
  Fly   356 PQKSLAEHKVSKVMNAPKEYYPVGYDKNFDDNFKSKVDLPPTSFSCAKQKHFPGLYADTDLGCMV 420

  Fly    92 YHVCHDGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCEEATHFYHLNADPEHNPYIPKKKPEL 156
            :|||....:|.....|||...|:|:|....|:||:.|.|..:|..|..|.....:..:.|.....
  Fly   421 FHVCALTDDGMVRKSFLCPENTLFDQTILKCNWWFYVDCSSSTSVYDSNIPISKSYQLMKSLTYF 485

  Fly   157 EPYA 160
            ..||
  Fly   486 SKYA 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 19/49 (39%)
mtgNP_731221.2 CBM_14 409..459 CDD:279884 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.