DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and CG13675

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_001261563.1 Gene:CG13675 / 38907 FlyBaseID:FBgn0035845 Length:355 Species:Drosophila melanogaster


Alignment Length:163 Identity:54/163 - (33%)
Similarity:70/163 - (42%) Gaps:39/163 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NPPQPEHPQHHEKKQDL-----------------------NKIPG-VPGVDYPIYHEVPH-THFS 71
            :|.|    |.|.::|.|                       .:|.| ..|.|||.|..||. ..|:
  Fly    11 SPQQ----QQHRRQQHLQWSACIMIVVFGLFSMLAGNCVNGQIDGYTAGEDYPAYDAVPKGLAFN 71

  Fly    72 CHNVPATPGMYANVETGCQAYHVC-HDGREGDQGAKFLCTNGTIFNQKEFACDWWYNVKCEEATH 135
            |..  ..||.||:.||.||.:|.| |.|.:    ..|||.|||:|||....||||.||.||.:..
  Fly    72 CQG--RQPGYYADTETRCQVWHWCLHSGHQ----YSFLCPNGTVFNQAVRVCDWWSNVNCEGSEQ 130

  Fly   136 FYHLNADPEHNPYIPKKKPELEPYANDIHDASK 168
            .|. |.|..:.  ||:::.:|... .:..|..|
  Fly   131 LYQ-NNDELYR--IPERQQQLNDVXYEADDEYK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 26/50 (52%)
CG13675NP_001261563.1 CBM_14 72..125 CDD:279884 28/58 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472725
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.