DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and CG12009

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_647799.1 Gene:CG12009 / 38405 FlyBaseID:FBgn0035430 Length:905 Species:Drosophila melanogaster


Alignment Length:117 Identity:42/117 - (35%)
Similarity:59/117 - (50%) Gaps:27/117 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 HFSCHNVPATPGMYANVETGCQAYHVC-----HDGREGDQGAKFLCTNGTIFNQKEFAC----DW 124
            :|||.|  .|.|.||:||..||.:|||     .||||......|:|...|||:|:.|.|    | 
  Fly    79 NFSCVN--KTYGYYADVENDCQIFHVCLPVTYADGRENTFRWSFICPEETIFSQESFTCMRRED- 140

  Fly   125 WYNVKCEEATHFYHLN------ADPEHNP-----YIPKK---KPELEPYAND 162
             ..::||:::.:|.||      |:.|..|     ..|:|   :||.||..::
  Fly   141 -MTIECEDSSRYYELNGNFGGPAEEESKPTPVESEEPEKEESEPEPEPVESE 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 23/58 (40%)
CG12009NP_647799.1 CBM_14 82..145 CDD:279884 26/66 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.