DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and ckd

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_647796.2 Gene:ckd / 38402 FlyBaseID:FBgn0035427 Length:140 Species:Drosophila melanogaster


Alignment Length:151 Identity:42/151 - (27%)
Similarity:71/151 - (47%) Gaps:42/151 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FSFWLMFVVG--------AAVAIEVQKFGYLFNPPQPEHP--QHHEKKQDLNKIPGVPGVDYPIY 62
            :|:.::::.|        ||:|::.|         :|..|  |:|:.|:..|    :..:.:   
  Fly     9 YSYRILWLSGVLLGPILLAAIAVQGQ---------EPASPVFQNHKTKEWTN----LDNITF--- 57

  Fly    63 HEVPHTHFSCHNVPATPGMYANVETGCQAYHVCHDGREGDQGAKFLCTNGTIFNQKEFACDWWYN 127
                  .|.|..  .:.|.||::|..||.:|:|.:  ||:: ...||.|.|.|||:...|||.||
  Fly    58 ------SFDCKR--RSVGFYADMEYNCQIFHMCDE--EGNR-IPHLCANETSFNQEYRICDWDYN 111

  Fly   128 VKCEEATHFYHLN-----ADP 143
            ..|.|:..:::||     .||
  Fly   112 FNCTESPKWFYLNELTYATDP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 22/49 (45%)
ckdNP_647796.2 CBM_14 61..111 CDD:279884 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.