DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32036 and CG5756

DIOPT Version :9

Sequence 1:NP_729504.2 Gene:CG32036 / 39105 FlyBaseID:FBgn0052036 Length:173 Species:Drosophila melanogaster
Sequence 2:NP_611292.2 Gene:CG5756 / 37064 FlyBaseID:FBgn0034301 Length:1220 Species:Drosophila melanogaster


Alignment Length:153 Identity:54/153 - (35%)
Similarity:74/153 - (48%) Gaps:26/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMPKLGCFSFWLMFVVGAAVAIEVQKFGYLFNPPQPEHPQHHEKKQDL--------NKIPGVPGV 57
            |.|...|....|..:||.|.|....:          ||.:..:|..:.        :.|||.||:
  Fly     1 MWPPSSCLWLALALLVGVAQAQSGSR----------EHFEDADKSSEYTDQQFDLRHTIPGEPGL 55

  Fly    58 DYPIYHEVPHTHFSC---HNVPATPGMYANVETGCQAYHVCHDGREGDQGAKFLCTNGTIFNQKE 119
            ||||....|.|.|.|   |.     |.||:||:.|||:.:|.......||..|||.|||:|:||.
  Fly    56 DYPILSSPPRTSFVCKGRHE-----GYYADVESRCQAFRICAHTARSPQGFGFLCPNGTLFSQKN 115

  Fly   120 FACDWWYNVKCEEATHFYHLNAD 142
            |.|||:.||.|:::..:|.:|.:
  Fly   116 FVCDWYRNVNCDDSEKYYEMNEE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32036NP_729504.2 CBM_14 80..130 CDD:279884 26/49 (53%)
CG5756NP_611292.2 CBM_14 70..126 CDD:279884 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012706
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22933
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.