powered by:
Protein Alignment CG32036 and Y56A3A.6
DIOPT Version :9
Sequence 1: | NP_729504.2 |
Gene: | CG32036 / 39105 |
FlyBaseID: | FBgn0052036 |
Length: | 173 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499539.1 |
Gene: | Y56A3A.6 / 176618 |
WormBaseID: | WBGene00013227 |
Length: | 798 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 11/38 - (28%) |
Similarity: | 16/38 - (42%) |
Gaps: | 12/38 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 PPQPEHPQHHEKKQDLNKIPGVPGVDYPIYHEVPHTHF 70
||.|.| :||: .|:||...::...|.|
Worm 181 PPPPPH-----RKQE-------NGIDYEAMYKSLLTKF 206
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32036 | NP_729504.2 |
CBM_14 |
80..130 |
CDD:279884 |
|
Y56A3A.6 | NP_499539.1 |
PHA03247 |
<448..704 |
CDD:223021 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160167600 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22933 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.