DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pall and Fbxo28

DIOPT Version :9

Sequence 1:NP_648325.2 Gene:pall / 39104 FlyBaseID:FBgn0036005 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001100673.1 Gene:Fbxo28 / 305105 RGDID:1304584 Length:368 Species:Rattus norvegicus


Alignment Length:329 Identity:116/329 - (35%)
Similarity:184/329 - (55%) Gaps:48/329 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIMAHAKNFKRIKSMLPRRE 67
            |:.||...|::||..:.|||:::.|.||...:.:.|::||:||.|:...|....|::|:.|||||
  Rat    64 LVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQVKAQLPRRE 128

  Fly    68 SERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDEINSILRILSTSTKQLRP 132
            ||||||.|:||:|||.::|||:|:|.||:.|::|.|:||||||:|:|||..:||.::::....|.
  Rat   129 SERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRVLRYVNSTRAPQRA 193

  Fly   133 HEVLQELRDISSMAIEHFDEKIAVNFKLEHRKQLAESTAAGARLVVCSALGDISFSGVRRTGISR 197
            ||||||||||||||:|:|||||....|    ::|..|..:|                 |..| |.
  Rat   194 HEVLQELRDISSMAMEYFDEKIVPILK----RKLPGSDVSG-----------------RLMG-SP 236

  Fly   198 PVDHGLVQQAIVQLAPISASKSHSDSSQKDRMSKQLFKQ----YQLQRSLSQ---KIRLLEVSRK 255
            ||.........:||    .||.:....:..::.:|:...    ..|:|.:|:   |::..:...:
  Rat   237 PVPGPSAALTTMQL----FSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQ 297

  Fly   256 VQDRRLQEALSSITELTTQVSELKRQMEDVVANM-----------PSCAVKRQAVASADCLPPAL 309
            .||::|.|....|.|...:::||:|::.:|:.:.           .|...:|:|..:.|    :|
  Rat   298 DQDQKLLEQTQIIGEQNARLAELERKLREVMESAVGTSSGSGQSEESPRKRRKATEAID----SL 358

  Fly   310 KKPK 313
            :|.|
  Rat   359 RKSK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pallNP_648325.2 None
Fbxo28NP_001100673.1 F-box 67..108 CDD:279040 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346558
Domainoid 1 1.000 153 1.000 Domainoid score I4211
eggNOG 1 0.900 - - E1_28KQY
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3966
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346120at33208
OrthoFinder 1 1.000 - - FOG0008425
OrthoInspector 1 1.000 - - oto97150
orthoMCL 1 0.900 - - OOG6_110167
Panther 1 1.100 - - LDO PTHR13252
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6415
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.