DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pall and FBXO28

DIOPT Version :9

Sequence 1:NP_648325.2 Gene:pall / 39104 FlyBaseID:FBgn0036005 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_055991.1 Gene:FBXO28 / 23219 HGNCID:29046 Length:368 Species:Homo sapiens


Alignment Length:329 Identity:116/329 - (35%)
Similarity:184/329 - (55%) Gaps:48/329 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIMAHAKNFKRIKSMLPRRE 67
            |:.||...|::||..:.|||:::.|.||...:.:.|::||:||.|:...|....|::|:.|||||
Human    64 LVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQVKAQLPRRE 128

  Fly    68 SERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDEINSILRILSTSTKQLRP 132
            ||||||.|:||:|||.::|||:|:|.||:.|::|.|:||||||:|:|||..:||.::::....|.
Human   129 SERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRVLRYVNSTRAPQRA 193

  Fly   133 HEVLQELRDISSMAIEHFDEKIAVNFKLEHRKQLAESTAAGARLVVCSALGDISFSGVRRTGISR 197
            ||||||||||||||:|:|||||....|    ::|..|..:|                 |..| |.
Human   194 HEVLQELRDISSMAMEYFDEKIVPILK----RKLPGSDVSG-----------------RLMG-SP 236

  Fly   198 PVDHGLVQQAIVQLAPISASKSHSDSSQKDRMSKQLFKQ----YQLQRSLSQ---KIRLLEVSRK 255
            ||.........:||    .||.:....:..::.:|:...    ..|:|.:|:   |::..:...:
Human   237 PVPGPSAALTTMQL----FSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQ 297

  Fly   256 VQDRRLQEALSSITELTTQVSELKRQMEDVV-----------ANMPSCAVKRQAVASADCLPPAL 309
            .||::|.|....|.|...:::||:|::.:|:           .|..|...:::|..:.|    :|
Human   298 DQDQKLLEQTQIIGEQNARLAELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAID----SL 358

  Fly   310 KKPK 313
            :|.|
Human   359 RKSK 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pallNP_648325.2 None
FBXO28NP_055991.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
F-box 67..108 CDD:366220 16/40 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..368 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152968
Domainoid 1 1.000 153 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_28KQY
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4065
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346120at33208
OrthoFinder 1 1.000 - - FOG0008425
OrthoInspector 1 1.000 - - oto90035
orthoMCL 1 0.900 - - OOG6_110167
Panther 1 1.100 - - LDO PTHR13252
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5631
SonicParanoid 1 1.000 - - X6415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.