DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pall and fbxo28

DIOPT Version :9

Sequence 1:NP_648325.2 Gene:pall / 39104 FlyBaseID:FBgn0036005 Length:314 Species:Drosophila melanogaster
Sequence 2:NP_001096500.1 Gene:fbxo28 / 100125127 XenbaseID:XB-GENE-993737 Length:345 Species:Xenopus tropicalis


Alignment Length:320 Identity:115/320 - (35%)
Similarity:177/320 - (55%) Gaps:44/320 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIMAHAKNFKRIKSMLPRRE 67
            ||.||...|::|...:.|||:::.|.||...:.:.|::||:||.::...|....|::|:.|||||
 Frog    41 LLGLPIVAIENIFNFMNYDEISQLRLVCKRMDAVCQRMLNQGFLRVERYHNLCQKQVKAQLPRRE 105

  Fly    68 SERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDEINSILRILSTSTKQLRP 132
            ||||||.|:||:|||.::|||:|:|.||:.|::|.|:||||||:|:|||..:||.::::....|.
 Frog   106 SERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRVLRYVNSTRAPQRA 170

  Fly   133 HEVLQELRDISSMAIEHFDEKIAVNFKLEHRKQLAESTAAGARLVVCSALGDISFSGVRRTGISR 197
            ||||||||||||||:|:|||||....|    |:|..|..:| ||:.                 |.
 Frog   171 HEVLQELRDISSMAMEYFDEKIVPILK----KKLPGSEVSG-RLIG-----------------SP 213

  Fly   198 PVDHGLVQQAIVQLAPISASKSHSDSSQKDRMSKQL----FKQYQLQRSLSQ---KIRLLEVSRK 255
            ||.......:.:||    .||......:..::.:|:    .....|:|.||:   |::..:...:
 Frog   214 PVPGPSTALSTMQL----FSKQSPSRQEVTKLQQQVKANGAGMTVLRRELSELRTKVQEQQKQLQ 274

  Fly   256 VQDRRLQEALSSITELTTQVSELKRQMEDVVANM-----------PSCAVKRQAVASADC 304
            .||::|.|....|.|...:::||:.::.|||...           .|...:::.|...||
 Frog   275 DQDQKLLEQTQIIGEQNVRLTELEHKLRDVVERAVGGSSGAGQRDDSPRKRKKVVEVVDC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pallNP_648325.2 None
fbxo28NP_001096500.1 F-box 40..>71 CDD:366220 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4168
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 177 1.000 Inparanoid score I3930
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D346120at33208
OrthoFinder 1 1.000 - - FOG0008425
OrthoInspector 1 1.000 - - oto103843
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.