DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jarid2 and Kdm4A

DIOPT Version :9

Sequence 1:NP_648324.1 Gene:Jarid2 / 39103 FlyBaseID:FBgn0036004 Length:2351 Species:Drosophila melanogaster
Sequence 2:NP_610331.1 Gene:Kdm4A / 35744 FlyBaseID:FBgn0033233 Length:495 Species:Drosophila melanogaster


Alignment Length:376 Identity:85/376 - (22%)
Similarity:136/376 - (36%) Gaps:72/376 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly  1945 ESEEEIDGVSME-----C-IVKG-------------RSMPLSQFYRIARNTMALWFKSTDPTVNE 1990
            :|..:||.::|.     | :|.|             |.|.|.||...|.:.:....:..|  .::
  Fly    61 KSGYDIDNINMTIPAPICQVVTGAHGVYQQINIQQRRQMTLRQFMEKANSELHQTPRHFD--YDD 123

  Fly  1991 VEAEFWRHVAVRDSHVCVHSGSIDSSGWGYGFPSP----GPKGKGSNYARHPWN------LKVLT 2045
            :|.::|:::.                     :.||    ..||..|:.....||      :..|.
  Fly   124 LERKYWKNIT---------------------YISPLYAADVKGSLSDEDLDVWNIGRLDTILNLV 167

  Fly  2046 NNSGSVLRSLGPVMGVTVPTLHVGMLFSACCWYRDPHGLSWIEYLHTGASKLWYGIPDDQSANFR 2110
            |...:::     :.||....|:.||..|:..|:.:...|..|.|||.||.|.||.||........
  Fly   168 NTDYNII-----IDGVNTAYLYFGMWKSSFAWHTEDMDLYSINYLHFGAPKTWYAIPPAYGRRLE 227

  Fly  2111 AALTSLIPTHCQNKTIWLPCDTVMVPPHMLTDRGVSLCRIEQKPGEFIVVFPRAYTSSLATGYVV 2175
            .........:.|....:|.....|:.|.:|....:...:|.|:.||.::.||..|.:....|:..
  Fly   228 KLANETFSENYQECNAYLRHKMTMISPKVLRQHNIPYNKITQEAGEIMITFPFGYHAGFNHGFNG 292

  Fly  2176 SESVYFATMSWLDLAKDDFRDIHESCEPAMFSLEQLLFALGYDQRVNSEALHQMLPMLNDVCEKE 2240
            :||..||:..|::..|   |.....|...|..:....|.    :|...|.....|...:..|..|
  Fly   293 AESTNFASKRWIEYGK---RASICRCRSDMVKISMETFV----RRFQPERYDNWLKGQDMGCHPE 350

  Fly  2241 SAAREQLRAAGVTSTEKVQAEKGQKAKKQQQPPYKSIESECDL----CRAN 2287
            ...: ...||..|..|..:.|..:.||.:::.|.|   ..|.|    |..|
  Fly   351 EPGK-ICAAAPPTLNEYEKQENLRAAKSEEESPQK---RGCSLAGNGCERN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jarid2NP_648324.1 JmjN 1740..1781 CDD:128818
ARID 1812..1893 CDD:279697
JmjC 2066..2181 CDD:202224 32/114 (28%)
zf-C5HC2 2281..2334 CDD:280996 4/11 (36%)
Kdm4ANP_610331.1 JmjN 17..59 CDD:301729
JmjC 182..298 CDD:202224 32/115 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455776
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10694
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.