DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jarid2 and Atp5f1b

DIOPT Version :9

Sequence 1:NP_648324.1 Gene:Jarid2 / 39103 FlyBaseID:FBgn0036004 Length:2351 Species:Drosophila melanogaster
Sequence 2:NP_599191.1 Gene:Atp5f1b / 171374 RGDID:621368 Length:529 Species:Rattus norvegicus


Alignment Length:452 Identity:87/452 - (19%)
Similarity:138/452 - (30%) Gaps:161/452 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 GKAGKKKAEDAPADEEDLAP-PSSKKVATNARGSRKSAKSKASEDSAELEPQRSQRPSRKTKEAA 627
            |:.....|..|......||. |.:..:...|......|:..|::.||          :.|...|.
  Rat     6 GRVASASASGALRGLNPLAALPQAHLLLRTAPAGVHPARDYAAQSSA----------APKAGTAT 60

  Fly   628 AIYMGIIGHKLQLADDEEDDLSMSSFPDIPNVKEMEKMENEIKRNAAGKLNVPEAST-------- 684
            ...:.:||..:.:..||       ..|.|.|..|::..|:.:....|..|......|        
  Rat    61 GQIVAVIGAVVDVQFDE-------GLPPILNALEVQGRESRLVLEVAQHLGESTVRTIAMDGTEG 118

  Fly   685 ------VLSAGKSTRKP--------------SPRPKDSPVT----APVEATRNESPSPPEAEEEK 725
                  ||.:|...:.|              .|..:..|:.    ||:.|   |:|...|...|:
  Rat   119 LVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHA---EAPEFIEMSVEQ 180

  Fly   726 P------------PPPARRGR---------------------PPKQN---KVNAGPAHKPRIEG- 753
            .            .|.|:.|:                     ..|.:   .|.||...:.| || 
  Rat   181 EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTR-EGN 244

  Fly   754 ----MLVKKGSLAKMSEQQAKPKAKSEHSKVDSDEEEDFLINEELNE----------TKRKLEKS 804
                .:::.|.:          ..|...|||       .|:..::||          |...:.:.
  Rat   245 DLYHEMIESGVI----------NLKDATSKV-------ALVYGQMNEPPGARARVALTGLTVAEY 292

  Fly   805 FSDSDDEPLAIKVPAV-----AVKEKELLPPKMASPPPKLVPVPSPISVPTPAVSVAPSLAVPSI 864
            |.|.:.:.:.:.:..:     |..|...|          |..:||       ||...|:||    
  Rat   293 FRDQEGQDVLLFIDNIFRFTQAGSEVSAL----------LGRIPS-------AVGYQPTLA---- 336

  Fly   865 LPTSTGTTQLTMLPLTAKATSSLGSMPMFPSIQASYSPLKTMEKKPPVPTSKILNVPATYAL 926
              |..||.|..:      .|:..||:   .|:||.|.|...:  ..|.|.:...::.||..|
  Rat   337 --TDMGTMQERI------TTTKKGSI---TSVQAIYVPADDL--TDPAPATTFAHLDATTVL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jarid2NP_648324.1 JmjN 1740..1781 CDD:128818
ARID 1812..1893 CDD:279697
JmjC 2066..2181 CDD:202224
zf-C5HC2 2281..2334 CDD:280996
Atp5f1bNP_599191.1 PRK09280 58..524 CDD:236447 75/390 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0055
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.